PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10031900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 354aa    MW: 40892.1 Da    PI: 6.5117
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10031900genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.21.6e-17449147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg W + Ede+l+++v+++G+++W++Ia ++  gR++k+c++rw++ 
      Lus10031900  4 RGHWRPAEDEKLKELVERYGPHNWNAIADKLH-GRSGKSCRLRWYNQ 49
                     899*****************************.************96 PP

2Myb_DNA-binding54.13.5e-1756100147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r ++T eE+e+l+  ++ +G++ W+ Iar ++ gRt++ +k++w+  
      Lus10031900  56 RTPFTDEEEERLIASHRIHGNR-WAVIARLFP-GRTDNAVKNHWHVM 100
                      679*******************.*********.***********975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.858150IPR017930Myb domain
SMARTSM007171.3E-15352IPR001005SANT/Myb domain
SuperFamilySSF466897.86E-29497IPR009057Homeodomain-like
PfamPF002496.4E-17450IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.7E-27557IPR009057Homeodomain-like
CDDcd001674.71E-14748No hitNo description
PROSITE profilePS5129425.47851105IPR017930Myb domain
SMARTSM007171.2E-1555103IPR001005SANT/Myb domain
PfamPF002497.3E-145699IPR001005SANT/Myb domain
CDDcd001671.13E-1158101No hitNo description
Gene3DG3DSA:1.10.10.601.2E-2058104IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MCSRGHWRPA EDEKLKELVE RYGPHNWNAI ADKLHGRSGK SCRLRWYNQL DPRINRTPFT  60
DEEEERLIAS HRIHGNRWAV IARLFPGRTD NAVKNHWHVM MARRCRERSK SSSSGGSSSV  120
HRNNATSMAV DPRLTAGSAA MLNIMKLSSS SSHGGVASYL QPGYRPYYYG NRQQDQATAK  180
SLQQLAASYV MNKCFNMFDA KKTTTQTTTR RFHPYHPHLR PHPHYLFPKD YYLMAHSHNL  240
LHQEKEKEEK EEKGSIEYYD FLQVHNKNEN SNKSEVIDKT PDHLPQLGED EEEEEEEEEE  300
EEVDQYDNDQ SKQEGHDTLP TIEEEIDKVV GFIDFLDVGA TTREQTLASS WSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C6e-3211051105C-Myb DNA-Binding Domain
1msf_C6e-3211051105C-Myb DNA-Binding Domain
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00145DAPTransfer from AT1G17950Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23034243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17950.16e-70myb domain protein 52